PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011084710.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family LBD
Protein Properties Length: 191aa    MW: 20720.4 Da    PI: 9.0986
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011084710.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26068.21.8e-21858151
          DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpe 51
                    +CaaCk+lrrkC+++Cv+apyfp +qp++ + vhk+FGasnv+kll++l++
  XP_011084710.1  8 PCAACKFLRRKCQPECVFAPYFPPDQPQNQRPVHKVFGASNVTKLLNELRP 58
                    7**********************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089114.8497110IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-20858IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MASSSTSPCA ACKFLRRKCQ PECVFAPYFP PDQPQNQRPV HKVFGASNVT KLLNELRPAP  60
VYGCVGVISL LQHQLRQLQM DLSCAKSELS KYQNLGLSSH GLIAAAHHHH HHQGINILGG  120
GGGVSSRDHH HFHHQLFPVN QQQVIRAFDG SNGYDASGLL AMNMSSSIGQ LSGFQPSRAA  180
ADGRRTPVEP S
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR0765292e-37KR076529.1 Boehmeria nivea lateral organ boundaries domain protein (LBD3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011084710.11e-139PREDICTED: LOW QUALITY PROTEIN: LOB domain-containing protein 6
SwissprotO044791e-57LBD6_ARATH; LOB domain-containing protein 6
TrEMBLA0A022RIE08e-87A0A022RIE0_ERYGU; Uncharacterized protein
STRINGVIT_00s0340g00090.t011e-83(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.41e-51LBD family protein